PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G0941
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 247aa    MW: 28328.7 Da    PI: 5.9717
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G0941genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-17855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed ll++ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
      Gh_D07G0941  8 KGPWTEQEDILLANFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 55
                     79********************************************97 PP

2Myb_DNA-binding53.26.8e-1762106248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g++T+ E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
      Gh_D07G0941  62 GKMTPHEERLVLELHAKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 106
                      899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.369355IPR017930Myb domain
SuperFamilySSF466891.12E-296102IPR009057Homeodomain-like
SMARTSM007171.8E-15757IPR001005SANT/Myb domain
PfamPF002491.0E-16855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-20962IPR009057Homeodomain-like
CDDcd001672.41E-111055No hitNo description
PROSITE profilePS5129424.83556110IPR017930Myb domain
SMARTSM007174.2E-1660108IPR001005SANT/Myb domain
PfamPF002496.9E-1561105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2363108IPR009057Homeodomain-like
CDDcd001674.67E-1263106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MVQDEIRKGP WTEQEDILLA NFVHLFGDRR WDFIAKVSGL NRTGKSCRLR WVNYLHPGLK  60
TGKMTPHEER LVLELHAKWG NRWSRIARKL PGRTDNEIKN YWRTHMRKTA QEKKRAIPIS  120
PSSSSSNCHS SSSTVTAVDS LPSSGTGNIV SFYDTGGLDM AGKKNSPEFE DGNGYSMDDI  180
WKDIDMPEED TIIKPLPDNY SQQGCNFSWE YCWDSLWKMD DEEESKMFFP PNQLVSCFDF  240
GTESVTG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2651101105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012474427.10.0PREDICTED: transcription factor MYB59-like isoform X1
SwissprotQ4JL841e-92MYB59_ARATH; Transcription factor MYB59
SwissprotQ9LX822e-92MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A0D2PWT30.0A0A0D2PWT3_G
STRINGVIT_06s0004g04140.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25022774
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.36e-92myb domain protein 59